1073 lines
35 KiB
C
1073 lines
35 KiB
C
|
|
/* The MIT License
|
||
|
|
|
||
|
|
Copyright (c) 2003-2006, 2008, 2009, by Heng Li <lh3lh3@gmail.com>
|
||
|
|
|
||
|
|
Permission is hereby granted, free of charge, to any person obtaining
|
||
|
|
a copy of this software and associated documentation files (the
|
||
|
|
"Software"), to deal in the Software without restriction, including
|
||
|
|
without limitation the rights to use, copy, modify, merge, publish,
|
||
|
|
distribute, sublicense, and/or sell copies of the Software, and to
|
||
|
|
permit persons to whom the Software is furnished to do so, subject to
|
||
|
|
the following conditions:
|
||
|
|
|
||
|
|
The above copyright notice and this permission notice shall be
|
||
|
|
included in all copies or substantial portions of the Software.
|
||
|
|
|
||
|
|
THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
|
||
|
|
EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
|
||
|
|
MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND
|
||
|
|
NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS
|
||
|
|
BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN
|
||
|
|
ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN
|
||
|
|
CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
|
||
|
|
SOFTWARE.
|
||
|
|
*/
|
||
|
|
|
||
|
|
#include <stdlib.h>
|
||
|
|
#include <stdio.h>
|
||
|
|
#include <string.h>
|
||
|
|
#include <stdint.h>
|
||
|
|
#include "stdaln.h"
|
||
|
|
|
||
|
|
/* char -> 17 (=16+1) nucleotides */
|
||
|
|
unsigned char aln_nt16_table[256] = {
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,16 /*'-'*/,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
||
|
|
15, 1,14, 4, 11,15,15, 2, 13,15,15,10, 15, 5,15,15,
|
||
|
|
15,15, 3, 6, 8,15, 7, 9, 0,12,15,15, 15,15,15,15,
|
||
|
|
15, 1,14, 4, 11,15,15, 2, 13,15,15,10, 15, 5,15,15,
|
||
|
|
15,15, 3, 6, 8,15, 7, 9, 0,12,15,15, 15,15,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15,
|
||
|
|
15,15,15,15, 15,15,15,15, 15,15,15,15, 15,15,15,15
|
||
|
|
};
|
||
|
|
char *aln_nt16_rev_table = "XAGRCMSVTWKDYHBN-";
|
||
|
|
|
||
|
|
/* char -> 5 (=4+1) nucleotides */
|
||
|
|
unsigned char aln_nt4_table[256] = {
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 5 /*'-'*/, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 0, 4, 2, 4, 4, 4, 1, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 3, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 0, 4, 2, 4, 4, 4, 1, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 3, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4,
|
||
|
|
4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4, 4
|
||
|
|
};
|
||
|
|
char *aln_nt4_rev_table = "AGCTN-";
|
||
|
|
|
||
|
|
/* char -> 22 (=20+1+1) amino acids */
|
||
|
|
unsigned char aln_aa_table[256] = {
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,20,21, 21,22 /*'-'*/,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
||
|
|
21, 0,21, 4, 3, 6,13, 7, 8, 9,21,11, 10,12, 2,21,
|
||
|
|
14, 5, 1,15, 16,21,19,17, 21,18,21,21, 21,21,21,21,
|
||
|
|
21, 0,21, 4, 3, 6,13, 7, 8, 9,21,11, 10,12, 2,21,
|
||
|
|
14, 5, 1,15, 16,21,19,17, 21,18,21,21, 21,21,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21,
|
||
|
|
21,21,21,21, 21,21,21,21, 21,21,21,21, 21,21,21,21
|
||
|
|
};
|
||
|
|
char *aln_aa_rev_table = "ARNDCQEGHILKMFPSTWYV*X-";
|
||
|
|
/* 01234567890123456789012 */
|
||
|
|
|
||
|
|
/* translation table. They are useless in stdaln.c, but when you realize you need it, you need not write the table again. */
|
||
|
|
unsigned char aln_trans_table_eu[66] = {
|
||
|
|
11,11, 2, 2, 1, 1,15,15, 16,16,16,16, 9,12, 9, 9,
|
||
|
|
6, 6, 3, 3, 7, 7, 7, 7, 0, 0, 0, 0, 19,19,19,19,
|
||
|
|
5, 5, 8, 8, 1, 1, 1, 1, 14,14,14,14, 10,10,10,10,
|
||
|
|
20,20,18,18, 20,17, 4, 4, 15,15,15,15, 10,10,13,13, 21, 22
|
||
|
|
};
|
||
|
|
char *aln_trans_table_eu_char = "KKNNRRSSTTTTIMIIEEDDGGGGAAAAVVVVQQHHRRRRPPPPLLLL**YY*WCCSSSSLLFFX";
|
||
|
|
/* 01234567890123456789012345678901234567890123456789012345678901234 */
|
||
|
|
int aln_sm_blosum62[] = {
|
||
|
|
/* A R N D C Q E G H I L K M F P S T W Y V * X */
|
||
|
|
4,-1,-2,-2, 0,-1,-1, 0,-2,-1,-1,-1,-1,-2,-1, 1, 0,-3,-2, 0,-4, 0,
|
||
|
|
-1, 5, 0,-2,-3, 1, 0,-2, 0,-3,-2, 2,-1,-3,-2,-1,-1,-3,-2,-3,-4,-1,
|
||
|
|
-2, 0, 6, 1,-3, 0, 0, 0, 1,-3,-3, 0,-2,-3,-2, 1, 0,-4,-2,-3,-4,-1,
|
||
|
|
-2,-2, 1, 6,-3, 0, 2,-1,-1,-3,-4,-1,-3,-3,-1, 0,-1,-4,-3,-3,-4,-1,
|
||
|
|
0,-3,-3,-3, 9,-3,-4,-3,-3,-1,-1,-3,-1,-2,-3,-1,-1,-2,-2,-1,-4,-2,
|
||
|
|
-1, 1, 0, 0,-3, 5, 2,-2, 0,-3,-2, 1, 0,-3,-1, 0,-1,-2,-1,-2,-4,-1,
|
||
|
|
-1, 0, 0, 2,-4, 2, 5,-2, 0,-3,-3, 1,-2,-3,-1, 0,-1,-3,-2,-2,-4,-1,
|
||
|
|
0,-2, 0,-1,-3,-2,-2, 6,-2,-4,-4,-2,-3,-3,-2, 0,-2,-2,-3,-3,-4,-1,
|
||
|
|
-2, 0, 1,-1,-3, 0, 0,-2, 8,-3,-3,-1,-2,-1,-2,-1,-2,-2, 2,-3,-4,-1,
|
||
|
|
-1,-3,-3,-3,-1,-3,-3,-4,-3, 4, 2,-3, 1, 0,-3,-2,-1,-3,-1, 3,-4,-1,
|
||
|
|
-1,-2,-3,-4,-1,-2,-3,-4,-3, 2, 4,-2, 2, 0,-3,-2,-1,-2,-1, 1,-4,-1,
|
||
|
|
-1, 2, 0,-1,-3, 1, 1,-2,-1,-3,-2, 5,-1,-3,-1, 0,-1,-3,-2,-2,-4,-1,
|
||
|
|
-1,-1,-2,-3,-1, 0,-2,-3,-2, 1, 2,-1, 5, 0,-2,-1,-1,-1,-1, 1,-4,-1,
|
||
|
|
-2,-3,-3,-3,-2,-3,-3,-3,-1, 0, 0,-3, 0, 6,-4,-2,-2, 1, 3,-1,-4,-1,
|
||
|
|
-1,-2,-2,-1,-3,-1,-1,-2,-2,-3,-3,-1,-2,-4, 7,-1,-1,-4,-3,-2,-4,-2,
|
||
|
|
1,-1, 1, 0,-1, 0, 0, 0,-1,-2,-2, 0,-1,-2,-1, 4, 1,-3,-2,-2,-4, 0,
|
||
|
|
0,-1, 0,-1,-1,-1,-1,-2,-2,-1,-1,-1,-1,-2,-1, 1, 5,-2,-2, 0,-4, 0,
|
||
|
|
-3,-3,-4,-4,-2,-2,-3,-2,-2,-3,-2,-3,-1, 1,-4,-3,-2,11, 2,-3,-4,-2,
|
||
|
|
-2,-2,-2,-3,-2,-1,-2,-3, 2,-1,-1,-2,-1, 3,-3,-2,-2, 2, 7,-1,-4,-1,
|
||
|
|
0,-3,-3,-3,-1,-2,-2,-3,-3, 3, 1,-2, 1,-1,-2,-2, 0,-3,-1, 4,-4,-1,
|
||
|
|
-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4,-4, 1,-4,
|
||
|
|
0,-1,-1,-1,-2,-1,-1,-1,-1,-1,-1,-1,-1,-1,-2, 0, 0,-2,-1,-1,-4,-1
|
||
|
|
};
|
||
|
|
|
||
|
|
int aln_sm_blosum45[] = {
|
||
|
|
/* A R N D C Q E G H I L K M F P S T W Y V * X */
|
||
|
|
5,-2,-1,-2,-1,-1,-1, 0,-2,-1,-1,-1,-1,-2,-1, 1, 0,-2,-2, 0,-5, 0,
|
||
|
|
-2, 7, 0,-1,-3, 1, 0,-2, 0,-3,-2, 3,-1,-2,-2,-1,-1,-2,-1,-2,-5,-1,
|
||
|
|
-1, 0, 6, 2,-2, 0, 0, 0, 1,-2,-3, 0,-2,-2,-2, 1, 0,-4,-2,-3,-5,-1,
|
||
|
|
-2,-1, 2, 7,-3, 0, 2,-1, 0,-4,-3, 0,-3,-4,-1, 0,-1,-4,-2,-3,-5,-1,
|
||
|
|
-1,-3,-2,-3,12,-3,-3,-3,-3,-3,-2,-3,-2,-2,-4,-1,-1,-5,-3,-1,-5,-2,
|
||
|
|
-1, 1, 0, 0,-3, 6, 2,-2, 1,-2,-2, 1, 0,-4,-1, 0,-1,-2,-1,-3,-5,-1,
|
||
|
|
-1, 0, 0, 2,-3, 2, 6,-2, 0,-3,-2, 1,-2,-3, 0, 0,-1,-3,-2,-3,-5,-1,
|
||
|
|
0,-2, 0,-1,-3,-2,-2, 7,-2,-4,-3,-2,-2,-3,-2, 0,-2,-2,-3,-3,-5,-1,
|
||
|
|
-2, 0, 1, 0,-3, 1, 0,-2,10,-3,-2,-1, 0,-2,-2,-1,-2,-3, 2,-3,-5,-1,
|
||
|
|
-1,-3,-2,-4,-3,-2,-3,-4,-3, 5, 2,-3, 2, 0,-2,-2,-1,-2, 0, 3,-5,-1,
|
||
|
|
-1,-2,-3,-3,-2,-2,-2,-3,-2, 2, 5,-3, 2, 1,-3,-3,-1,-2, 0, 1,-5,-1,
|
||
|
|
-1, 3, 0, 0,-3, 1, 1,-2,-1,-3,-3, 5,-1,-3,-1,-1,-1,-2,-1,-2,-5,-1,
|
||
|
|
-1,-1,-2,-3,-2, 0,-2,-2, 0, 2, 2,-1, 6, 0,-2,-2,-1,-2, 0, 1,-5,-1,
|
||
|
|
-2,-2,-2,-4,-2,-4,-3,-3,-2, 0, 1,-3, 0, 8,-3,-2,-1, 1, 3, 0,-5,-1,
|
||
|
|
-1,-2,-2,-1,-4,-1, 0,-2,-2,-2,-3,-1,-2,-3, 9,-1,-1,-3,-3,-3,-5,-1,
|
||
|
|
1,-1, 1, 0,-1, 0, 0, 0,-1,-2,-3,-1,-2,-2,-1, 4, 2,-4,-2,-1,-5, 0,
|
||
|
|
0,-1, 0,-1,-1,-1,-1,-2,-2,-1,-1,-1,-1,-1,-1, 2, 5,-3,-1, 0,-5, 0,
|
||
|
|
-2,-2,-4,-4,-5,-2,-3,-2,-3,-2,-2,-2,-2, 1,-3,-4,-3,15, 3,-3,-5,-2,
|
||
|
|
-2,-1,-2,-2,-3,-1,-2,-3, 2, 0, 0,-1, 0, 3,-3,-2,-1, 3, 8,-1,-5,-1,
|
||
|
|
0,-2,-3,-3,-1,-3,-3,-3,-3, 3, 1,-2, 1, 0,-3,-1, 0,-3,-1, 5,-5,-1,
|
||
|
|
-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5,-5, 1,-5,
|
||
|
|
0,-1,-1,-1,-2,-1,-1,-1,-1,-1,-1,-1,-1,-1,-1, 0, 0,-2,-1,-1,-5,-1
|
||
|
|
};
|
||
|
|
|
||
|
|
int aln_sm_nt[] = {
|
||
|
|
/* X A G R C M S V T W K D Y H B N */
|
||
|
|
-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,-2,
|
||
|
|
-2, 2,-1, 1,-2, 1,-2, 0,-2, 1,-2, 0,-2, 0,-2, 0,
|
||
|
|
-2,-1, 2, 1,-2,-2, 1, 0,-2,-2, 1, 0,-2,-2, 0, 0,
|
||
|
|
-2, 1, 1, 1,-2,-1,-1, 0,-2,-1,-1, 0,-2, 0, 0, 0,
|
||
|
|
-2,-2,-2,-2, 2, 1, 1, 0,-1,-2,-2,-2, 1, 0, 0, 0,
|
||
|
|
-2, 1,-2,-1, 1, 1,-1, 0,-2,-1,-2, 0,-1, 0, 0, 0,
|
||
|
|
-2,-2, 1,-1, 1,-1, 1, 0,-2,-2,-1, 0,-1, 0, 0, 0,
|
||
|
|
-2, 0, 0, 0, 0, 0, 0, 0,-2, 0, 0, 0, 0, 0, 0, 0,
|
||
|
|
-2,-2,-2,-2,-1,-2,-2,-2, 2, 1, 1, 0, 1, 0, 0, 0,
|
||
|
|
-2, 1,-2,-1,-2,-1,-2, 0, 1, 1,-1, 0,-1, 0, 0, 0,
|
||
|
|
-2,-2, 1,-1,-2,-2,-1, 0, 1,-1, 1, 0,-1, 0, 0, 0,
|
||
|
|
-2, 0, 0, 0,-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
||
|
|
-2,-2,-2,-2, 1,-1,-1, 0, 1,-1,-1, 0, 1, 0, 0, 0,
|
||
|
|
-2, 0,-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
||
|
|
-2,-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
||
|
|
-2, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0
|
||
|
|
};
|
||
|
|
|
||
|
|
int aln_sm_read[] = {
|
||
|
|
/* X A G R C M S V T W K D Y H B N */
|
||
|
|
-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,-17,
|
||
|
|
-17, 2,-17, 1,-17, 1,-17, 0,-17, 1,-17, 0,-17, 0,-17, 0,
|
||
|
|
-17,-17, 2, 1,-17,-17, 1, 0,-17,-17, 1, 0,-17,-17, 0, 0,
|
||
|
|
-17, 1, 1, 1,-17,-17,-17, 0,-17,-17,-17, 0,-17, 0, 0, 0,
|
||
|
|
-17,-17,-17,-17, 2, 1, 1, 0,-17,-17,-17,-17, 1, 0, 0, 0,
|
||
|
|
-17, 1,-17,-17, 1, 1,-17, 0,-17,-17,-17, 0,-17, 0, 0, 0,
|
||
|
|
-17,-17, 1,-17, 1,-17, 1, 0,-17,-17,-17, 0,-17, 0, 0, 0,
|
||
|
|
-17, 0, 0, 0, 0, 0, 0, 0,-17, 0, 0, 0, 0, 0, 0, 0,
|
||
|
|
-17,-17,-17,-17,-17,-17,-17,-17, 2, 1, 1, 0, 1, 0, 0, 0,
|
||
|
|
-17, 1,-17,-17,-17,-17,-17, 0, 1, 1,-17, 0,-17, 0, 0, 0,
|
||
|
|
-17,-17, 1,-17,-17,-17,-17, 0, 1,-17, 1, 0,-17, 0, 0, 0,
|
||
|
|
-17, 0, 0, 0,-17, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
||
|
|
-17,-17,-17,-17, 1,-17,-17, 0, 1,-17,-17, 0, 1, 0, 0, 0,
|
||
|
|
-17, 0,-17, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
||
|
|
-17,-17, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0,
|
||
|
|
-17, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0
|
||
|
|
};
|
||
|
|
|
||
|
|
int aln_sm_hs[] = {
|
||
|
|
/* A G C T N */
|
||
|
|
91, -31,-114,-123, -44,
|
||
|
|
-31, 100,-125,-114, -42,
|
||
|
|
-123,-125, 100, -31, -42,
|
||
|
|
-114,-114, -31, 91, -42,
|
||
|
|
-44, -42, -42, -42, -43
|
||
|
|
};
|
||
|
|
|
||
|
|
int aln_sm_maq[] = {
|
||
|
|
11, -19, -19, -19, -13,
|
||
|
|
-19, 11, -19, -19, -13,
|
||
|
|
-19, -19, 11, -19, -13,
|
||
|
|
-19, -19, -19, 11, -13,
|
||
|
|
-13, -13, -13, -13, -13
|
||
|
|
};
|
||
|
|
|
||
|
|
int aln_sm_blast[] = {
|
||
|
|
1, -3, -3, -3, -2,
|
||
|
|
-3, 1, -3, -3, -2,
|
||
|
|
-3, -3, 1, -3, -2,
|
||
|
|
-3, -3, -3, 1, -2,
|
||
|
|
-2, -2, -2, -2, -2
|
||
|
|
};
|
||
|
|
|
||
|
|
/********************/
|
||
|
|
/* START OF align.c */
|
||
|
|
/********************/
|
||
|
|
|
||
|
|
AlnParam aln_param_blast = { 5, 2, 2, aln_sm_blast, 5, 50 };
|
||
|
|
AlnParam aln_param_bwa = { 26, 9, 5, aln_sm_maq, 5, 50 };
|
||
|
|
AlnParam aln_param_nt2nt = { 8, 2, 2, aln_sm_nt, 16, 75 };
|
||
|
|
AlnParam aln_param_rd2rd = { 1, 19, 19, aln_sm_read, 16, 75 };
|
||
|
|
AlnParam aln_param_aa2aa = { 10, 2, 2, aln_sm_blosum62, 22, 50 };
|
||
|
|
|
||
|
|
AlnAln *aln_init_AlnAln()
|
||
|
|
{
|
||
|
|
AlnAln *aa;
|
||
|
|
aa = (AlnAln*)malloc(sizeof(AlnAln));
|
||
|
|
aa->path = 0;
|
||
|
|
aa->out1 = aa->out2 = aa->outm = 0;
|
||
|
|
aa->path_len = 0;
|
||
|
|
return aa;
|
||
|
|
}
|
||
|
|
void aln_free_AlnAln(AlnAln *aa)
|
||
|
|
{
|
||
|
|
free(aa->path); free(aa->cigar32);
|
||
|
|
free(aa->out1); free(aa->out2); free(aa->outm);
|
||
|
|
free(aa);
|
||
|
|
}
|
||
|
|
|
||
|
|
/***************************/
|
||
|
|
/* START OF common_align.c */
|
||
|
|
/***************************/
|
||
|
|
|
||
|
|
#define LOCAL_OVERFLOW_THRESHOLD 32000
|
||
|
|
#define LOCAL_OVERFLOW_REDUCE 16000
|
||
|
|
#define NT_LOCAL_SCORE int
|
||
|
|
#define NT_LOCAL_SHIFT 16
|
||
|
|
#define NT_LOCAL_MASK 0xffff
|
||
|
|
|
||
|
|
#define SET_INF(s) (s).M = (s).I = (s).D = MINOR_INF;
|
||
|
|
|
||
|
|
#define set_M(MM, cur, p, sc) \
|
||
|
|
{ \
|
||
|
|
if ((p)->M >= (p)->I) { \
|
||
|
|
if ((p)->M >= (p)->D) { \
|
||
|
|
(MM) = (p)->M + (sc); (cur)->Mt = FROM_M; \
|
||
|
|
} else { \
|
||
|
|
(MM) = (p)->D + (sc); (cur)->Mt = FROM_D; \
|
||
|
|
} \
|
||
|
|
} else { \
|
||
|
|
if ((p)->I > (p)->D) { \
|
||
|
|
(MM) = (p)->I + (sc); (cur)->Mt = FROM_I; \
|
||
|
|
} else { \
|
||
|
|
(MM) = (p)->D + (sc); (cur)->Mt = FROM_D; \
|
||
|
|
} \
|
||
|
|
} \
|
||
|
|
}
|
||
|
|
#define set_I(II, cur, p) \
|
||
|
|
{ \
|
||
|
|
if ((p)->M - gap_open > (p)->I) { \
|
||
|
|
(cur)->It = FROM_M; \
|
||
|
|
(II) = (p)->M - gap_open - gap_ext; \
|
||
|
|
} else { \
|
||
|
|
(cur)->It = FROM_I; \
|
||
|
|
(II) = (p)->I - gap_ext; \
|
||
|
|
} \
|
||
|
|
}
|
||
|
|
#define set_end_I(II, cur, p) \
|
||
|
|
{ \
|
||
|
|
if (gap_end >= 0) { \
|
||
|
|
if ((p)->M - gap_open > (p)->I) { \
|
||
|
|
(cur)->It = FROM_M; \
|
||
|
|
(II) = (p)->M - gap_open - gap_end; \
|
||
|
|
} else { \
|
||
|
|
(cur)->It = FROM_I; \
|
||
|
|
(II) = (p)->I - gap_end; \
|
||
|
|
} \
|
||
|
|
} else set_I(II, cur, p); \
|
||
|
|
}
|
||
|
|
#define set_D(DD, cur, p) \
|
||
|
|
{ \
|
||
|
|
if ((p)->M - gap_open > (p)->D) { \
|
||
|
|
(cur)->Dt = FROM_M; \
|
||
|
|
(DD) = (p)->M - gap_open - gap_ext; \
|
||
|
|
} else { \
|
||
|
|
(cur)->Dt = FROM_D; \
|
||
|
|
(DD) = (p)->D - gap_ext; \
|
||
|
|
} \
|
||
|
|
}
|
||
|
|
#define set_end_D(DD, cur, p) \
|
||
|
|
{ \
|
||
|
|
if (gap_end >= 0) { \
|
||
|
|
if ((p)->M - gap_open > (p)->D) { \
|
||
|
|
(cur)->Dt = FROM_M; \
|
||
|
|
(DD) = (p)->M - gap_open - gap_end; \
|
||
|
|
} else { \
|
||
|
|
(cur)->Dt = FROM_D; \
|
||
|
|
(DD) = (p)->D - gap_end; \
|
||
|
|
} \
|
||
|
|
} else set_D(DD, cur, p); \
|
||
|
|
}
|
||
|
|
|
||
|
|
typedef struct
|
||
|
|
{
|
||
|
|
unsigned char Mt:3, It:2, Dt:2;
|
||
|
|
} dpcell_t;
|
||
|
|
|
||
|
|
typedef struct
|
||
|
|
{
|
||
|
|
int M, I, D;
|
||
|
|
} dpscore_t;
|
||
|
|
|
||
|
|
/* build score profile for accelerating alignment, in theory */
|
||
|
|
void aln_init_score_array(unsigned char *seq, int len, int row, int *score_matrix, int **s_array)
|
||
|
|
{
|
||
|
|
int *tmp, *tmp2, i, k;
|
||
|
|
for (i = 0; i != row; ++i) {
|
||
|
|
tmp = score_matrix + i * row;
|
||
|
|
tmp2 = s_array[i];
|
||
|
|
for (k = 0; k != len; ++k)
|
||
|
|
tmp2[k] = tmp[seq[k]];
|
||
|
|
}
|
||
|
|
}
|
||
|
|
/***************************
|
||
|
|
* banded global alignment *
|
||
|
|
***************************/
|
||
|
|
int aln_global_core(unsigned char *seq1, int len1, unsigned char *seq2, int len2, const AlnParam *ap,
|
||
|
|
path_t *path, int *path_len)
|
||
|
|
{
|
||
|
|
register int i, j;
|
||
|
|
dpcell_t **dpcell, *q;
|
||
|
|
dpscore_t *curr, *last, *s;
|
||
|
|
path_t *p;
|
||
|
|
int b1, b2, tmp_end;
|
||
|
|
int *mat, end, max;
|
||
|
|
unsigned char type, ctype;
|
||
|
|
|
||
|
|
int gap_open, gap_ext, gap_end, b;
|
||
|
|
int *score_matrix, N_MATRIX_ROW;
|
||
|
|
|
||
|
|
/* initialize some align-related parameters. just for compatibility */
|
||
|
|
gap_open = ap->gap_open;
|
||
|
|
gap_ext = ap->gap_ext;
|
||
|
|
gap_end = ap->gap_end;
|
||
|
|
b = ap->band_width;
|
||
|
|
score_matrix = ap->matrix;
|
||
|
|
N_MATRIX_ROW = ap->row;
|
||
|
|
|
||
|
|
if (len1 == 0 || len2 == 0) {
|
||
|
|
*path_len = 0;
|
||
|
|
return 0;
|
||
|
|
}
|
||
|
|
/* calculate b1 and b2 */
|
||
|
|
if (len1 > len2) {
|
||
|
|
b1 = len1 - len2 + b;
|
||
|
|
b2 = b;
|
||
|
|
} else {
|
||
|
|
b1 = b;
|
||
|
|
b2 = len2 - len1 + b;
|
||
|
|
}
|
||
|
|
if (b1 > len1) b1 = len1;
|
||
|
|
if (b2 > len2) b2 = len2;
|
||
|
|
--seq1; --seq2;
|
||
|
|
|
||
|
|
/* allocate memory */
|
||
|
|
end = (b1 + b2 <= len1)? (b1 + b2 + 1) : (len1 + 1);
|
||
|
|
dpcell = (dpcell_t**)malloc(sizeof(dpcell_t*) * (len2 + 1));
|
||
|
|
for (j = 0; j <= len2; ++j)
|
||
|
|
dpcell[j] = (dpcell_t*)malloc(sizeof(dpcell_t) * end);
|
||
|
|
for (j = b2 + 1; j <= len2; ++j)
|
||
|
|
dpcell[j] -= j - b2;
|
||
|
|
curr = (dpscore_t*)malloc(sizeof(dpscore_t) * (len1 + 1));
|
||
|
|
last = (dpscore_t*)malloc(sizeof(dpscore_t) * (len1 + 1));
|
||
|
|
|
||
|
|
/* set first row */
|
||
|
|
SET_INF(*curr); curr->M = 0;
|
||
|
|
for (i = 1, s = curr + 1; i < b1; ++i, ++s) {
|
||
|
|
SET_INF(*s);
|
||
|
|
set_end_D(s->D, dpcell[0] + i, s - 1);
|
||
|
|
}
|
||
|
|
s = curr; curr = last; last = s;
|
||
|
|
|
||
|
|
/* core dynamic programming, part 1 */
|
||
|
|
tmp_end = (b2 < len2)? b2 : len2 - 1;
|
||
|
|
for (j = 1; j <= tmp_end; ++j) {
|
||
|
|
q = dpcell[j]; s = curr; SET_INF(*s);
|
||
|
|
set_end_I(s->I, q, last);
|
||
|
|
end = (j + b1 <= len1 + 1)? (j + b1 - 1) : len1;
|
||
|
|
mat = score_matrix + seq2[j] * N_MATRIX_ROW;
|
||
|
|
++s; ++q;
|
||
|
|
for (i = 1; i != end; ++i, ++s, ++q) {
|
||
|
|
set_M(s->M, q, last + i - 1, mat[seq1[i]]); /* this will change s->M ! */
|
||
|
|
set_I(s->I, q, last + i);
|
||
|
|
set_D(s->D, q, s - 1);
|
||
|
|
}
|
||
|
|
set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
||
|
|
set_D(s->D, q, s - 1);
|
||
|
|
if (j + b1 - 1 > len1) { /* bug fixed, 040227 */
|
||
|
|
set_end_I(s->I, q, last + i);
|
||
|
|
} else s->I = MINOR_INF;
|
||
|
|
s = curr; curr = last; last = s;
|
||
|
|
}
|
||
|
|
/* last row for part 1, use set_end_D() instead of set_D() */
|
||
|
|
if (j == len2 && b2 != len2 - 1) {
|
||
|
|
q = dpcell[j]; s = curr; SET_INF(*s);
|
||
|
|
set_end_I(s->I, q, last);
|
||
|
|
end = (j + b1 <= len1 + 1)? (j + b1 - 1) : len1;
|
||
|
|
mat = score_matrix + seq2[j] * N_MATRIX_ROW;
|
||
|
|
++s; ++q;
|
||
|
|
for (i = 1; i != end; ++i, ++s, ++q) {
|
||
|
|
set_M(s->M, q, last + i - 1, mat[seq1[i]]); /* this will change s->M ! */
|
||
|
|
set_I(s->I, q, last + i);
|
||
|
|
set_end_D(s->D, q, s - 1);
|
||
|
|
}
|
||
|
|
set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
||
|
|
set_end_D(s->D, q, s - 1);
|
||
|
|
if (j + b1 - 1 > len1) { /* bug fixed, 040227 */
|
||
|
|
set_end_I(s->I, q, last + i);
|
||
|
|
} else s->I = MINOR_INF;
|
||
|
|
s = curr; curr = last; last = s;
|
||
|
|
++j;
|
||
|
|
}
|
||
|
|
|
||
|
|
/* core dynamic programming, part 2 */
|
||
|
|
for (; j <= len2 - b2 + 1; ++j) {
|
||
|
|
SET_INF(curr[j - b2]);
|
||
|
|
mat = score_matrix + seq2[j] * N_MATRIX_ROW;
|
||
|
|
end = j + b1 - 1;
|
||
|
|
for (i = j - b2 + 1, q = dpcell[j] + i, s = curr + i; i != end; ++i, ++s, ++q) {
|
||
|
|
set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
||
|
|
set_I(s->I, q, last + i);
|
||
|
|
set_D(s->D, q, s - 1);
|
||
|
|
}
|
||
|
|
set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
||
|
|
set_D(s->D, q, s - 1);
|
||
|
|
s->I = MINOR_INF;
|
||
|
|
s = curr; curr = last; last = s;
|
||
|
|
}
|
||
|
|
|
||
|
|
/* core dynamic programming, part 3 */
|
||
|
|
for (; j < len2; ++j) {
|
||
|
|
SET_INF(curr[j - b2]);
|
||
|
|
mat = score_matrix + seq2[j] * N_MATRIX_ROW;
|
||
|
|
for (i = j - b2 + 1, q = dpcell[j] + i, s = curr + i; i < len1; ++i, ++s, ++q) {
|
||
|
|
set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
||
|
|
set_I(s->I, q, last + i);
|
||
|
|
set_D(s->D, q, s - 1);
|
||
|
|
}
|
||
|
|
set_M(s->M, q, last + len1 - 1, mat[seq1[i]]);
|
||
|
|
set_end_I(s->I, q, last + i);
|
||
|
|
set_D(s->D, q, s - 1);
|
||
|
|
s = curr; curr = last; last = s;
|
||
|
|
}
|
||
|
|
/* last row */
|
||
|
|
if (j == len2) {
|
||
|
|
SET_INF(curr[j - b2]);
|
||
|
|
mat = score_matrix + seq2[j] * N_MATRIX_ROW;
|
||
|
|
for (i = j - b2 + 1, q = dpcell[j] + i, s = curr + i; i < len1; ++i, ++s, ++q) {
|
||
|
|
set_M(s->M, q, last + i - 1, mat[seq1[i]]);
|
||
|
|
set_I(s->I, q, last + i);
|
||
|
|
set_end_D(s->D, q, s - 1);
|
||
|
|
}
|
||
|
|
set_M(s->M, q, last + len1 - 1, mat[seq1[i]]);
|
||
|
|
set_end_I(s->I, q, last + i);
|
||
|
|
set_end_D(s->D, q, s - 1);
|
||
|
|
s = curr; curr = last; last = s;
|
||
|
|
}
|
||
|
|
|
||
|
|
/* backtrace */
|
||
|
|
i = len1; j = len2;
|
||
|
|
q = dpcell[j] + i;
|
||
|
|
s = last + len1;
|
||
|
|
max = s->M; type = q->Mt; ctype = FROM_M;
|
||
|
|
if (s->I > max) { max = s->I; type = q->It; ctype = FROM_I; }
|
||
|
|
if (s->D > max) { max = s->D; type = q->Dt; ctype = FROM_D; }
|
||
|
|
|
||
|
|
p = path;
|
||
|
|
p->ctype = ctype; p->i = i; p->j = j; /* bug fixed 040408 */
|
||
|
|
++p;
|
||
|
|
do {
|
||
|
|
switch (ctype) {
|
||
|
|
case FROM_M: --i; --j; break;
|
||
|
|
case FROM_I: --j; break;
|
||
|
|
case FROM_D: --i; break;
|
||
|
|
}
|
||
|
|
q = dpcell[j] + i;
|
||
|
|
ctype = type;
|
||
|
|
switch (type) {
|
||
|
|
case FROM_M: type = q->Mt; break;
|
||
|
|
case FROM_I: type = q->It; break;
|
||
|
|
case FROM_D: type = q->Dt; break;
|
||
|
|
}
|
||
|
|
p->ctype = ctype; p->i = i; p->j = j;
|
||
|
|
++p;
|
||
|
|
} while (i || j);
|
||
|
|
*path_len = p - path - 1;
|
||
|
|
|
||
|
|
/* free memory */
|
||
|
|
for (j = b2 + 1; j <= len2; ++j)
|
||
|
|
dpcell[j] += j - b2;
|
||
|
|
for (j = 0; j <= len2; ++j)
|
||
|
|
free(dpcell[j]);
|
||
|
|
free(dpcell);
|
||
|
|
free(curr); free(last);
|
||
|
|
|
||
|
|
return max;
|
||
|
|
}
|
||
|
|
/*************************************************
|
||
|
|
* local alignment combined with banded strategy *
|
||
|
|
*************************************************/
|
||
|
|
int aln_local_core(unsigned char *seq1, int len1, unsigned char *seq2, int len2, const AlnParam *ap,
|
||
|
|
path_t *path, int *path_len, int _thres, int *_subo)
|
||
|
|
{
|
||
|
|
register NT_LOCAL_SCORE *s;
|
||
|
|
register int i;
|
||
|
|
int q, r, qr, tmp_len, qr_shift;
|
||
|
|
int **s_array, *score_array;
|
||
|
|
int e, f;
|
||
|
|
int is_overflow, of_base;
|
||
|
|
NT_LOCAL_SCORE *eh, curr_h, last_h, curr_last_h;
|
||
|
|
int j, start_i, start_j, end_i, end_j;
|
||
|
|
path_t *p;
|
||
|
|
int score_f, score_r, score_g;
|
||
|
|
int start, end, max_score;
|
||
|
|
int thres, *suba, *ss;
|
||
|
|
|
||
|
|
int gap_open, gap_ext, b;
|
||
|
|
int *score_matrix, N_MATRIX_ROW;
|
||
|
|
|
||
|
|
/* initialize some align-related parameters. just for compatibility */
|
||
|
|
gap_open = ap->gap_open;
|
||
|
|
gap_ext = ap->gap_ext;
|
||
|
|
b = ap->band_width;
|
||
|
|
score_matrix = ap->matrix;
|
||
|
|
N_MATRIX_ROW = ap->row;
|
||
|
|
thres = _thres > 0? _thres : -_thres;
|
||
|
|
|
||
|
|
if (len1 == 0 || len2 == 0) return -1;
|
||
|
|
|
||
|
|
/* allocate memory */
|
||
|
|
suba = (int*)malloc(sizeof(int) * (len2 + 1));
|
||
|
|
eh = (NT_LOCAL_SCORE*)malloc(sizeof(NT_LOCAL_SCORE) * (len1 + 1));
|
||
|
|
s_array = (int**)malloc(sizeof(int*) * N_MATRIX_ROW);
|
||
|
|
for (i = 0; i != N_MATRIX_ROW; ++i)
|
||
|
|
s_array[i] = (int*)malloc(sizeof(int) * len1);
|
||
|
|
/* initialization */
|
||
|
|
aln_init_score_array(seq1, len1, N_MATRIX_ROW, score_matrix, s_array);
|
||
|
|
q = gap_open;
|
||
|
|
r = gap_ext;
|
||
|
|
qr = q + r;
|
||
|
|
qr_shift = (qr+1) << NT_LOCAL_SHIFT;
|
||
|
|
tmp_len = len1 + 1;
|
||
|
|
start_i = start_j = end_i = end_j = 0;
|
||
|
|
for (i = 0, max_score = 0; i != N_MATRIX_ROW * N_MATRIX_ROW; ++i)
|
||
|
|
if (max_score < score_matrix[i]) max_score = score_matrix[i];
|
||
|
|
/* convert the coordinate */
|
||
|
|
--seq1; --seq2;
|
||
|
|
for (i = 0; i != N_MATRIX_ROW; ++i) --s_array[i];
|
||
|
|
|
||
|
|
/* forward dynamic programming */
|
||
|
|
for (i = 0, s = eh; i != tmp_len; ++i, ++s) *s = 0;
|
||
|
|
score_f = 0;
|
||
|
|
is_overflow = of_base = 0;
|
||
|
|
suba[0] = 0;
|
||
|
|
for (j = 1, ss = suba + 1; j <= len2; ++j, ++ss) {
|
||
|
|
int subo = 0;
|
||
|
|
last_h = f = 0;
|
||
|
|
score_array = s_array[seq2[j]];
|
||
|
|
if (is_overflow) { /* adjust eh[] array if overflow occurs. */
|
||
|
|
/* If LOCAL_OVERFLOW_REDUCE is too small, optimal alignment might be missed.
|
||
|
|
* If it is too large, this block will be excuted frequently and therefore
|
||
|
|
* slow down the whole program.
|
||
|
|
* Acually, smaller LOCAL_OVERFLOW_REDUCE might also help to reduce the
|
||
|
|
* number of assignments because it sets some cells to zero when overflow
|
||
|
|
* happens. */
|
||
|
|
int tmp, tmp2;
|
||
|
|
score_f -= LOCAL_OVERFLOW_REDUCE;
|
||
|
|
of_base += LOCAL_OVERFLOW_REDUCE;
|
||
|
|
is_overflow = 0;
|
||
|
|
for (i = 1, s = eh; i <= tmp_len; ++i, ++s) {
|
||
|
|
tmp = *s >> NT_LOCAL_SHIFT; tmp2 = *s & NT_LOCAL_MASK;
|
||
|
|
if (tmp2 < LOCAL_OVERFLOW_REDUCE) tmp2 = 0;
|
||
|
|
else tmp2 -= LOCAL_OVERFLOW_REDUCE;
|
||
|
|
if (tmp < LOCAL_OVERFLOW_REDUCE) tmp = 0;
|
||
|
|
else tmp -= LOCAL_OVERFLOW_REDUCE;
|
||
|
|
*s = (tmp << NT_LOCAL_SHIFT) | tmp2;
|
||
|
|
}
|
||
|
|
}
|
||
|
|
for (i = 1, s = eh; i != tmp_len; ++i, ++s) {
|
||
|
|
/* prepare for calculate current h */
|
||
|
|
curr_h = (*s >> NT_LOCAL_SHIFT) + score_array[i];
|
||
|
|
if (curr_h < 0) curr_h = 0;
|
||
|
|
if (last_h > 0) { /* initialize f */
|
||
|
|
f = (f > last_h - q)? f - r : last_h - qr;
|
||
|
|
if (curr_h < f) curr_h = f;
|
||
|
|
}
|
||
|
|
if (*(s+1) >= qr_shift) { /* initialize e */
|
||
|
|
curr_last_h = *(s+1) >> NT_LOCAL_SHIFT;
|
||
|
|
e = ((*s & NT_LOCAL_MASK) > curr_last_h - q)? (*s & NT_LOCAL_MASK) - r : curr_last_h - qr;
|
||
|
|
if (curr_h < e) curr_h = e;
|
||
|
|
*s = (last_h << NT_LOCAL_SHIFT) | e;
|
||
|
|
} else *s = last_h << NT_LOCAL_SHIFT; /* e = 0 */
|
||
|
|
last_h = curr_h;
|
||
|
|
if (subo < curr_h) subo = curr_h;
|
||
|
|
if (score_f < curr_h) {
|
||
|
|
score_f = curr_h; end_i = i; end_j = j;
|
||
|
|
if (score_f > LOCAL_OVERFLOW_THRESHOLD) is_overflow = 1;
|
||
|
|
}
|
||
|
|
}
|
||
|
|
*s = last_h << NT_LOCAL_SHIFT;
|
||
|
|
*ss = subo + of_base;
|
||
|
|
}
|
||
|
|
score_f += of_base;
|
||
|
|
|
||
|
|
if (score_f < thres) { /* no matching residue at all, 090218 */
|
||
|
|
*path_len = 0;
|
||
|
|
goto end_func;
|
||
|
|
}
|
||
|
|
if (path == 0) goto end_func; /* skip path-filling */
|
||
|
|
|
||
|
|
/* reverse dynamic programming */
|
||
|
|
for (i = end_i, s = eh + end_i; i >= 0; --i, --s) *s = 0;
|
||
|
|
if (end_i == 0 || end_j == 0) goto end_func; /* no local match */
|
||
|
|
score_r = score_matrix[seq1[end_i] * N_MATRIX_ROW + seq2[end_j]];
|
||
|
|
is_overflow = of_base = 0;
|
||
|
|
start_i = end_i; start_j = end_j;
|
||
|
|
eh[end_i] = ((NT_LOCAL_SCORE)(qr + score_r)) << NT_LOCAL_SHIFT; /* in order to initialize f and e, 040408 */
|
||
|
|
start = end_i - 1;
|
||
|
|
end = end_i - 3;
|
||
|
|
if (end <= 0) end = 0;
|
||
|
|
|
||
|
|
/* second pass DP can be done in a band, speed will thus be enhanced */
|
||
|
|
for (j = end_j - 1; j != 0; --j) {
|
||
|
|
last_h = f = 0;
|
||
|
|
score_array = s_array[seq2[j]];
|
||
|
|
if (is_overflow) { /* adjust eh[] array if overflow occurs. */
|
||
|
|
int tmp, tmp2;
|
||
|
|
score_r -= LOCAL_OVERFLOW_REDUCE;
|
||
|
|
of_base += LOCAL_OVERFLOW_REDUCE;
|
||
|
|
is_overflow = 0;
|
||
|
|
for (i = start, s = eh + start + 1; i >= end; --i, --s) {
|
||
|
|
tmp = *s >> NT_LOCAL_SHIFT; tmp2 = *s & NT_LOCAL_MASK;
|
||
|
|
if (tmp2 < LOCAL_OVERFLOW_REDUCE) tmp2 = 0;
|
||
|
|
else tmp2 -= LOCAL_OVERFLOW_REDUCE;
|
||
|
|
if (tmp < LOCAL_OVERFLOW_REDUCE) tmp = 0;
|
||
|
|
else tmp -= LOCAL_OVERFLOW_REDUCE;
|
||
|
|
*s = (tmp << NT_LOCAL_SHIFT) | tmp2;
|
||
|
|
}
|
||
|
|
}
|
||
|
|
for (i = start, s = eh + start + 1; i != end; --i, --s) {
|
||
|
|
/* prepare for calculate current h */
|
||
|
|
curr_h = (*s >> NT_LOCAL_SHIFT) + score_array[i];
|
||
|
|
if (curr_h < 0) curr_h = 0;
|
||
|
|
if (last_h > 0) { /* initialize f */
|
||
|
|
f = (f > last_h - q)? f - r : last_h - qr;
|
||
|
|
if (curr_h < f) curr_h = f;
|
||
|
|
}
|
||
|
|
curr_last_h = *(s-1) >> NT_LOCAL_SHIFT;
|
||
|
|
e = ((*s & NT_LOCAL_MASK) > curr_last_h - q)? (*s & NT_LOCAL_MASK) - r : curr_last_h - qr;
|
||
|
|
if (e < 0) e = 0;
|
||
|
|
if (curr_h < e) curr_h = e;
|
||
|
|
*s = (last_h << NT_LOCAL_SHIFT) | e;
|
||
|
|
last_h = curr_h;
|
||
|
|
if (score_r < curr_h) {
|
||
|
|
score_r = curr_h; start_i = i; start_j = j;
|
||
|
|
if (score_r + of_base - qr == score_f) {
|
||
|
|
j = 1; break;
|
||
|
|
}
|
||
|
|
if (score_r > LOCAL_OVERFLOW_THRESHOLD) is_overflow = 1;
|
||
|
|
}
|
||
|
|
}
|
||
|
|
*s = last_h << NT_LOCAL_SHIFT;
|
||
|
|
/* recalculate start and end, the boundaries of the band */
|
||
|
|
if ((eh[start] >> NT_LOCAL_SHIFT) <= qr) --start;
|
||
|
|
if (start <= 0) start = 0;
|
||
|
|
end = start_i - (start_j - j) - (score_r + of_base + (start_j - j) * max_score) / r - 1;
|
||
|
|
if (end <= 0) end = 0;
|
||
|
|
}
|
||
|
|
|
||
|
|
if (_subo) {
|
||
|
|
int tmp2 = 0, tmp = (int)(start_j - .33 * (end_j - start_j) + .499);
|
||
|
|
for (j = 1; j <= tmp; ++j)
|
||
|
|
if (tmp2 < suba[j]) tmp2 = suba[j];
|
||
|
|
tmp = (int)(end_j + .33 * (end_j - start_j) + .499);
|
||
|
|
for (j = tmp; j <= len2; ++j)
|
||
|
|
if (tmp2 < suba[j]) tmp2 = suba[j];
|
||
|
|
*_subo = tmp2;
|
||
|
|
}
|
||
|
|
|
||
|
|
if (path_len == 0) {
|
||
|
|
path[0].i = start_i; path[0].j = start_j;
|
||
|
|
path[1].i = end_i; path[1].j = end_j;
|
||
|
|
goto end_func;
|
||
|
|
}
|
||
|
|
|
||
|
|
score_r += of_base;
|
||
|
|
score_r -= qr;
|
||
|
|
|
||
|
|
#ifdef DEBUG
|
||
|
|
/* this seems not a bug */
|
||
|
|
if (score_f != score_r)
|
||
|
|
fprintf(stderr, "[aln_local_core] unknown flaw occurs: score_f(%d) != score_r(%d)\n", score_f, score_r);
|
||
|
|
#endif
|
||
|
|
|
||
|
|
if (_thres > 0) { /* call global alignment to fill the path */
|
||
|
|
score_g = 0;
|
||
|
|
j = (end_i - start_i > end_j - start_j)? end_i - start_i : end_j - start_j;
|
||
|
|
++j; /* j is the maximum band_width */
|
||
|
|
for (i = ap->band_width;; i <<= 1) {
|
||
|
|
AlnParam ap_real = *ap;
|
||
|
|
ap_real.gap_end = -1;
|
||
|
|
ap_real.band_width = i;
|
||
|
|
score_g = aln_global_core(seq1 + start_i, end_i - start_i + 1, seq2 + start_j,
|
||
|
|
end_j - start_j + 1, &ap_real, path, path_len);
|
||
|
|
if (score_g == score_r || score_f == score_g) break;
|
||
|
|
if (i > j) break;
|
||
|
|
}
|
||
|
|
if (score_r > score_g && score_f > score_g) {
|
||
|
|
fprintf(stderr, "[aln_local_core] Potential bug: (%d,%d) > %d\n", score_f, score_r, score_g);
|
||
|
|
score_f = score_r = -1;
|
||
|
|
} else score_f = score_g;
|
||
|
|
|
||
|
|
/* convert coordinate */
|
||
|
|
for (p = path + *path_len - 1; p >= path; --p) {
|
||
|
|
p->i += start_i - 1;
|
||
|
|
p->j += start_j - 1;
|
||
|
|
}
|
||
|
|
} else { /* just store the start and end */
|
||
|
|
*path_len = 2;
|
||
|
|
path[1].i = start_i; path[1].j = start_j;
|
||
|
|
path->i = end_i; path->j = end_j;
|
||
|
|
}
|
||
|
|
|
||
|
|
end_func:
|
||
|
|
/* free */
|
||
|
|
free(eh); free(suba);
|
||
|
|
for (i = 0; i != N_MATRIX_ROW; ++i) {
|
||
|
|
++s_array[i];
|
||
|
|
free(s_array[i]);
|
||
|
|
}
|
||
|
|
free(s_array);
|
||
|
|
return score_f;
|
||
|
|
}
|
||
|
|
AlnAln *aln_stdaln_aux(const char *seq1, const char *seq2, const AlnParam *ap,
|
||
|
|
int type, int thres, int len1, int len2)
|
||
|
|
{
|
||
|
|
unsigned char *seq11, *seq22;
|
||
|
|
int score;
|
||
|
|
int i, j, l;
|
||
|
|
path_t *p;
|
||
|
|
char *out1, *out2, *outm;
|
||
|
|
AlnAln *aa;
|
||
|
|
|
||
|
|
if (len1 < 0) len1 = strlen(seq1);
|
||
|
|
if (len2 < 0) len2 = strlen(seq2);
|
||
|
|
|
||
|
|
aa = aln_init_AlnAln();
|
||
|
|
seq11 = (unsigned char*)malloc(sizeof(unsigned char) * len1);
|
||
|
|
seq22 = (unsigned char*)malloc(sizeof(unsigned char) * len2);
|
||
|
|
aa->path = (path_t*)malloc(sizeof(path_t) * (len1 + len2 + 1));
|
||
|
|
|
||
|
|
if (ap->row < 10) { /* 4-nucleotide alignment */
|
||
|
|
for (i = 0; i < len1; ++i)
|
||
|
|
seq11[i] = aln_nt4_table[(int)seq1[i]];
|
||
|
|
for (j = 0; j < len2; ++j)
|
||
|
|
seq22[j] = aln_nt4_table[(int)seq2[j]];
|
||
|
|
} else if (ap->row < 20) { /* 16-nucleotide alignment */
|
||
|
|
for (i = 0; i < len1; ++i)
|
||
|
|
seq11[i] = aln_nt16_table[(int)seq1[i]];
|
||
|
|
for (j = 0; j < len2; ++j)
|
||
|
|
seq22[j] = aln_nt16_table[(int)seq2[j]];
|
||
|
|
} else { /* amino acids */
|
||
|
|
for (i = 0; i < len1; ++i)
|
||
|
|
seq11[i] = aln_aa_table[(int)seq1[i]];
|
||
|
|
for (j = 0; j < len2; ++j)
|
||
|
|
seq22[j] = aln_aa_table[(int)seq2[j]];
|
||
|
|
}
|
||
|
|
|
||
|
|
if (type == ALN_TYPE_GLOBAL) score = aln_global_core(seq11, len1, seq22, len2, ap, aa->path, &aa->path_len);
|
||
|
|
else if (type == ALN_TYPE_LOCAL) score = aln_local_core(seq11, len1, seq22, len2, ap, aa->path, &aa->path_len, thres, &aa->subo);
|
||
|
|
else if (type == ALN_TYPE_EXTEND) score = aln_extend_core(seq11, len1, seq22, len2, ap, aa->path, &aa->path_len, 1, 0);
|
||
|
|
else {
|
||
|
|
free(seq11); free(seq22); free(aa->path);
|
||
|
|
aln_free_AlnAln(aa);
|
||
|
|
return 0;
|
||
|
|
}
|
||
|
|
aa->score = score;
|
||
|
|
|
||
|
|
if (thres > 0) {
|
||
|
|
out1 = aa->out1 = (char*)malloc(sizeof(char) * (aa->path_len + 1));
|
||
|
|
out2 = aa->out2 = (char*)malloc(sizeof(char) * (aa->path_len + 1));
|
||
|
|
outm = aa->outm = (char*)malloc(sizeof(char) * (aa->path_len + 1));
|
||
|
|
|
||
|
|
--seq1; --seq2;
|
||
|
|
--seq11; --seq22;
|
||
|
|
|
||
|
|
p = aa->path + aa->path_len - 1;
|
||
|
|
|
||
|
|
for (l = 0; p >= aa->path; --p, ++l) {
|
||
|
|
switch (p->ctype) {
|
||
|
|
case FROM_M: out1[l] = seq1[p->i]; out2[l] = seq2[p->j];
|
||
|
|
outm[l] = (seq11[p->i] == seq22[p->j] && seq11[p->i] != ap->row)? '|' : ' ';
|
||
|
|
break;
|
||
|
|
case FROM_I: out1[l] = '-'; out2[l] = seq2[p->j]; outm[l] = ' '; break;
|
||
|
|
case FROM_D: out1[l] = seq1[p->i]; out2[l] = '-'; outm[l] = ' '; break;
|
||
|
|
}
|
||
|
|
}
|
||
|
|
out1[l] = out2[l] = outm[l] = '\0';
|
||
|
|
++seq11; ++seq22;
|
||
|
|
}
|
||
|
|
|
||
|
|
free(seq11);
|
||
|
|
free(seq22);
|
||
|
|
|
||
|
|
p = aa->path + aa->path_len - 1;
|
||
|
|
aa->start1 = p->i? p->i : 1;
|
||
|
|
aa->end1 = aa->path->i;
|
||
|
|
aa->start2 = p->j? p->j : 1;
|
||
|
|
aa->end2 = aa->path->j;
|
||
|
|
aa->cigar32 = aln_path2cigar32(aa->path, aa->path_len, &aa->n_cigar);
|
||
|
|
|
||
|
|
return aa;
|
||
|
|
}
|
||
|
|
AlnAln *aln_stdaln(const char *seq1, const char *seq2, const AlnParam *ap, int type, int thres)
|
||
|
|
{
|
||
|
|
return aln_stdaln_aux(seq1, seq2, ap, type, thres, -1, -1);
|
||
|
|
}
|
||
|
|
|
||
|
|
/* for backward compatibility */
|
||
|
|
uint16_t *aln_path2cigar(const path_t *path, int path_len, int *n_cigar)
|
||
|
|
{
|
||
|
|
uint32_t *cigar32;
|
||
|
|
uint16_t *cigar;
|
||
|
|
int i;
|
||
|
|
cigar32 = aln_path2cigar32(path, path_len, n_cigar);
|
||
|
|
cigar = (uint16_t*)cigar32;
|
||
|
|
for (i = 0; i < *n_cigar; ++i)
|
||
|
|
cigar[i] = (cigar32[i]&0xf)<<14 | (cigar32[i]>>4&0x3fff);
|
||
|
|
return cigar;
|
||
|
|
}
|
||
|
|
|
||
|
|
/* newly added functions (2009-07-21) */
|
||
|
|
|
||
|
|
int aln_extend_core(unsigned char *seq1, int len1, unsigned char *seq2, int len2, const AlnParam *ap,
|
||
|
|
path_t *path, int *path_len, int G0, uint8_t *_mem)
|
||
|
|
{
|
||
|
|
int q, r, qr, tmp_len;
|
||
|
|
int32_t **s_array, *score_array;
|
||
|
|
int is_overflow, of_base;
|
||
|
|
uint32_t *eh;
|
||
|
|
int i, j, end_i, end_j;
|
||
|
|
int score, start, end;
|
||
|
|
int *score_matrix, N_MATRIX_ROW;
|
||
|
|
uint8_t *mem, *_p;
|
||
|
|
|
||
|
|
/* initialize some align-related parameters. just for compatibility */
|
||
|
|
q = ap->gap_open;
|
||
|
|
r = ap->gap_ext;
|
||
|
|
qr = q + r;
|
||
|
|
score_matrix = ap->matrix;
|
||
|
|
N_MATRIX_ROW = ap->row;
|
||
|
|
|
||
|
|
if (len1 == 0 || len2 == 0) return -1;
|
||
|
|
|
||
|
|
/* allocate memory */
|
||
|
|
mem = _mem? _mem : calloc((len1 + 2) * (N_MATRIX_ROW + 1), 4);
|
||
|
|
_p = mem;
|
||
|
|
eh = (uint32_t*)_p, _p += 4 * (len1 + 2);
|
||
|
|
s_array = calloc(N_MATRIX_ROW, sizeof(void*));
|
||
|
|
for (i = 0; i != N_MATRIX_ROW; ++i)
|
||
|
|
s_array[i] = (int32_t*)_p, _p += 4 * len1;
|
||
|
|
/* initialization */
|
||
|
|
aln_init_score_array(seq1, len1, N_MATRIX_ROW, score_matrix, s_array);
|
||
|
|
tmp_len = len1 + 1;
|
||
|
|
start = 1; end = 2;
|
||
|
|
end_i = end_j = 0;
|
||
|
|
score = 0;
|
||
|
|
is_overflow = of_base = 0;
|
||
|
|
/* convert the coordinate */
|
||
|
|
--seq1; --seq2;
|
||
|
|
for (i = 0; i != N_MATRIX_ROW; ++i) --s_array[i];
|
||
|
|
|
||
|
|
/* dynamic programming */
|
||
|
|
memset(eh, 0, 4 * (len1 + 2));
|
||
|
|
eh[1] = (uint32_t)G0<<16;
|
||
|
|
for (j = 1; j <= len2; ++j) {
|
||
|
|
int _start, _end;
|
||
|
|
int h1 = 0, f = 0;
|
||
|
|
score_array = s_array[seq2[j]];
|
||
|
|
/* set start and end */
|
||
|
|
_start = j - ap->band_width;
|
||
|
|
if (_start < 1) _start = 1;
|
||
|
|
if (_start > start) start = _start;
|
||
|
|
_end = j + ap->band_width;
|
||
|
|
if (_end > len1 + 1) _end = len1 + 1;
|
||
|
|
if (_end < end) end = _end;
|
||
|
|
if (start == end) break;
|
||
|
|
/* adjust eh[] array if overflow occurs. */
|
||
|
|
if (is_overflow) {
|
||
|
|
int tmp, tmp2;
|
||
|
|
score -= LOCAL_OVERFLOW_REDUCE;
|
||
|
|
of_base += LOCAL_OVERFLOW_REDUCE;
|
||
|
|
is_overflow = 0;
|
||
|
|
for (i = start; i <= end; ++i) {
|
||
|
|
uint32_t *s = &eh[i];
|
||
|
|
tmp = *s >> 16; tmp2 = *s & 0xffff;
|
||
|
|
if (tmp2 < LOCAL_OVERFLOW_REDUCE) tmp2 = 0;
|
||
|
|
else tmp2 -= LOCAL_OVERFLOW_REDUCE;
|
||
|
|
if (tmp < LOCAL_OVERFLOW_REDUCE) tmp = 0;
|
||
|
|
else tmp -= LOCAL_OVERFLOW_REDUCE;
|
||
|
|
*s = (tmp << 16) | tmp2;
|
||
|
|
}
|
||
|
|
}
|
||
|
|
_start = _end = 0;
|
||
|
|
/* the inner loop */
|
||
|
|
for (i = start; i < end; ++i) {
|
||
|
|
/* At the beginning of each cycle:
|
||
|
|
eh[i] -> h[j-1,i-1]<<16 | e[j,i]
|
||
|
|
f -> f[j,i]
|
||
|
|
h1 -> h[j,i-1]
|
||
|
|
*/
|
||
|
|
uint32_t *s = &eh[i];
|
||
|
|
int h = (int)(*s >> 16);
|
||
|
|
int e = *s & 0xffff; /* this is e[j,i] */
|
||
|
|
*s = (uint32_t)h1 << 16; /* eh[i] now stores h[j,i-1]<<16 */
|
||
|
|
h += h? score_array[i] : 0; /* this is left_core() specific */
|
||
|
|
/* calculate h[j,i]; don't need to test 0, as {e,f}>=0 */
|
||
|
|
h = h > e? h : e;
|
||
|
|
h = h > f? h : f; /* h now is h[j,i] */
|
||
|
|
h1 = h;
|
||
|
|
if (h > 0) {
|
||
|
|
if (_start == 0) _start = i;
|
||
|
|
_end = i;
|
||
|
|
if (score < h) {
|
||
|
|
score = h; end_i = i; end_j = j;
|
||
|
|
if (score > LOCAL_OVERFLOW_THRESHOLD) is_overflow = 1;
|
||
|
|
}
|
||
|
|
}
|
||
|
|
/* calculate e[j+1,i] and f[j,i+1] */
|
||
|
|
h -= qr;
|
||
|
|
h = h > 0? h : 0;
|
||
|
|
e -= r;
|
||
|
|
e = e > h? e : h;
|
||
|
|
f -= r;
|
||
|
|
f = f > h? f : h;
|
||
|
|
*s |= e;
|
||
|
|
}
|
||
|
|
eh[end] = h1 << 16;
|
||
|
|
/* recalculate start and end, the boundaries of the band */
|
||
|
|
if (_end <= 0) break; /* no cell in this row has a positive score */
|
||
|
|
start = _start;
|
||
|
|
end = _end + 3;
|
||
|
|
}
|
||
|
|
|
||
|
|
score += of_base - 1;
|
||
|
|
if (score <= 0) {
|
||
|
|
if (path_len) *path_len = 0;
|
||
|
|
goto end_left_func;
|
||
|
|
}
|
||
|
|
|
||
|
|
if (path == 0) goto end_left_func;
|
||
|
|
|
||
|
|
if (path_len == 0) {
|
||
|
|
path[0].i = end_i; path[0].j = end_j;
|
||
|
|
goto end_left_func;
|
||
|
|
}
|
||
|
|
|
||
|
|
{ /* call global alignment to fill the path */
|
||
|
|
int score_g = 0;
|
||
|
|
j = (end_i - 1 > end_j - 1)? end_i - 1 : end_j - 1;
|
||
|
|
++j; /* j is the maximum band_width */
|
||
|
|
for (i = ap->band_width;; i <<= 1) {
|
||
|
|
AlnParam ap_real = *ap;
|
||
|
|
ap_real.gap_end = -1;
|
||
|
|
ap_real.band_width = i;
|
||
|
|
score_g = aln_global_core(seq1 + 1, end_i, seq2 + 1, end_j, &ap_real, path, path_len);
|
||
|
|
if (score == score_g) break;
|
||
|
|
if (i > j) break;
|
||
|
|
}
|
||
|
|
if (score > score_g)
|
||
|
|
fprintf(stderr, "[aln_left_core] no suitable bandwidth: %d < %d\n", score_g, score);
|
||
|
|
score = score_g;
|
||
|
|
}
|
||
|
|
|
||
|
|
end_left_func:
|
||
|
|
/* free */
|
||
|
|
free(s_array);
|
||
|
|
if (!_mem) free(mem);
|
||
|
|
return score;
|
||
|
|
}
|
||
|
|
|
||
|
|
uint32_t *aln_path2cigar32(const path_t *path, int path_len, int *n_cigar)
|
||
|
|
{
|
||
|
|
int i, n;
|
||
|
|
uint32_t *cigar;
|
||
|
|
unsigned char last_type;
|
||
|
|
|
||
|
|
if (path_len == 0 || path == 0) {
|
||
|
|
*n_cigar = 0;
|
||
|
|
return 0;
|
||
|
|
}
|
||
|
|
|
||
|
|
last_type = path->ctype;
|
||
|
|
for (i = n = 1; i < path_len; ++i) {
|
||
|
|
if (last_type != path[i].ctype) ++n;
|
||
|
|
last_type = path[i].ctype;
|
||
|
|
}
|
||
|
|
*n_cigar = n;
|
||
|
|
cigar = (uint32_t*)malloc(*n_cigar * 4);
|
||
|
|
|
||
|
|
cigar[0] = 1u << 4 | path[path_len-1].ctype;
|
||
|
|
last_type = path[path_len-1].ctype;
|
||
|
|
for (i = path_len - 2, n = 0; i >= 0; --i) {
|
||
|
|
if (path[i].ctype == last_type) cigar[n] += 1u << 4;
|
||
|
|
else {
|
||
|
|
cigar[++n] = 1u << 4 | path[i].ctype;
|
||
|
|
last_type = path[i].ctype;
|
||
|
|
}
|
||
|
|
}
|
||
|
|
|
||
|
|
return cigar;
|
||
|
|
}
|
||
|
|
|
||
|
|
#ifdef STDALN_MAIN
|
||
|
|
int main()
|
||
|
|
{
|
||
|
|
AlnAln *aln_local, *aln_global, *aln_left;
|
||
|
|
int i;
|
||
|
|
|
||
|
|
aln_local = aln_stdaln("CGTGCGATGCactgCATACGGCTCGCCTAGATCA", "AAGGGATGCTCTGCATCgCTCGGCTAGCTGT", &aln_param_blast, 0, 1);
|
||
|
|
aln_global = aln_stdaln("CGTGCGATGCactgCATACGGCTCGCCTAGATCA", "AAGGGATGCTCTGCATCGgCTCGGCTAGCTGT", &aln_param_blast, 1, 1);
|
||
|
|
// aln_left = aln_stdaln( "GATGCACTGCATACGGCTCGCCTAGATCA", "GATGCTCTGCATCGgCTCGGCTAGCTGT", &aln_param_blast, 2, 1);
|
||
|
|
aln_left = aln_stdaln("CACCTTCGACTCACGTCTCATTCTCGGAGTCGAGTGGACGGTCCCTCATACACGAACAGGTTC",
|
||
|
|
"CACCTTCGACTTTCACCTCTCATTCTCGGACTCGAGTGGACGGTCCCTCATCCAAGAACAGGGTCTGTGAAA", &aln_param_blast, 2, 1);
|
||
|
|
|
||
|
|
printf(">%d,%d\t%d,%d\n", aln_local->start1, aln_local->end1, aln_local->start2, aln_local->end2);
|
||
|
|
printf("%s\n%s\n%s\n", aln_local->out1, aln_local->outm, aln_local->out2);
|
||
|
|
|
||
|
|
printf(">%d,%d\t%d,%d\t", aln_global->start1, aln_global->end1, aln_global->start2, aln_global->end2);
|
||
|
|
for (i = 0; i != aln_global->n_cigar; ++i)
|
||
|
|
printf("%d%c", aln_global->cigar32[i]>>4, "MID"[aln_global->cigar32[i]&0xf]);
|
||
|
|
printf("\n%s\n%s\n%s\n", aln_global->out1, aln_global->outm, aln_global->out2);
|
||
|
|
|
||
|
|
printf(">%d\t%d,%d\t%d,%d\t", aln_left->score, aln_left->start1, aln_left->end1, aln_left->start2, aln_left->end2);
|
||
|
|
for (i = 0; i != aln_left->n_cigar; ++i)
|
||
|
|
printf("%d%c", aln_left->cigar32[i]>>4, "MID"[aln_left->cigar32[i]&0xf]);
|
||
|
|
printf("\n%s\n%s\n%s\n", aln_left->out1, aln_left->outm, aln_left->out2);
|
||
|
|
|
||
|
|
aln_free_AlnAln(aln_local);
|
||
|
|
aln_free_AlnAln(aln_global);
|
||
|
|
aln_free_AlnAln(aln_left);
|
||
|
|
return 0;
|
||
|
|
}
|
||
|
|
#endif
|